Skip to main content

Table 1 Peptide sequences of gp114 derived from MS/MS spectra. Peptide sequences from gp114 produced by the interpretation of MS/MS spectra and MS BLAST alignments with corresponding peptides. X are unidentified amino acid residues, L stands for both Leu and Ile residues; B stands for a generic trypsin cleavage site (Arg or Lys); sequences in brackets present isobaric combinations of amino acid residues, which could not be distinguished because of the absence of the corresponding fragment ions in the mass spectrum. All peptide sequence candidates from all fragmented precursors were merged into a single MS BLAST search string. Multiple sequence candidates per each fragmented precursor were allowed. Peptides 2, 4, 5, 3 and 6 (underlined) are contained in one putative exon derived from sequence FE8.

From: Identification of glycosylated marker proteins of epithelial polarity in MDCK cells by homology driven proteomics

# m/z z m Sequence proposal Alignment Protein homologue
1 1185.6 3 3553.8 SNVLYGPDTPTLSQSLGNS Query: NVLYGPDTPTLSQS CEACAM8
      NVLYGPD PT+S S P31997
      Sbjct: NVLYGPDAPTISPS H. sapiens
2 693.3 3 2076.9 BXXTVESVPPNAAEGKDALLR Query: TVESVPPNAAEGKDALL CEACAM8
  1039 2    T+E VP NAAEGK+ LL P31997
      Sbjct: TIEAVPSNAAEGKEVLL H. sapiens
3 553.2 2 1104.4 BVTTPGPAYSGR Query: TPGPAYSGR CEACAM8
      TPGPAYS R P31997
      Sbjct: TPGPAYSNR H. sapiens
4 656.8 4 2623.2 B [VL]LPGDTASLTWFK [W/GE/AD/SV]TVLPXXK Query: WFKGETV CEACAM8
  875.4 3    W+KGETV P31997
      Sbjct: WYKGETV H. sapiens
5 539.2 2 1076.4 BLLLYVLDTK Query: BLLLYVLDT Q9NOP7
      +++ YV+ T CEA protein
      Sbjct: RIIGYVIAT P. hamadryas
6 425.2 2 848.4 BFETALLR No match  
7 386.2 2 770.4 BTVPDSPR No match  
  1. FE8 putative exon
  2. SLLAFWNPPTTAQVTVESVPPNAAEGKDALLR VLNLPGDTASLTWFKGETVLP THKILLYVIDTK ITTPGPAYSGR ETIY PNGSLLFQNITLNDTGSYILQIINQKFETAL VRGQLQVFRE